ATP2A3 Antikörper (N-Term)
-
- Target Alle ATP2A3 Antikörper anzeigen
- ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))
-
Bindungsspezifität
- AA 1-30, N-Term
-
Reaktivität
- Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP2A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 3(ATP2A3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- MEAAHLLPAA DVLRHFSVTA EGGLSPAQVT
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 3(ATP2A3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ATPase, Ca++ transporting, ubiquitous
Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ATP2A3 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ATP2A3 (ATPase, Ca++ Transporting, Ubiquitous (ATP2A3))
- Andere Bezeichnung
- ATP2A3 (ATP2A3 Produkte)
- Synonyme
- serca3 antikoerper, si:dkey-205l20.1 antikoerper, ATP2A3 antikoerper, Atp2a3 antikoerper, SERCA3 antikoerper, SERCA3b antikoerper, Serca3 antikoerper, SERCA antikoerper, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 L homeolog antikoerper, ATPase, Ca++ transporting, ubiquitous antikoerper, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 antikoerper, atp2a3.L antikoerper, atp2a3 antikoerper, ATP2A3 antikoerper, Atp2a3 antikoerper
- Hintergrund
-
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. What's more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.
Synonyms: Adenosine triphosphatase calcium antibody|AT2A3_HUMAN antibody|ATP2A3 antibody|ATPase Ca(2+) transporting ubiquitous antibody|ATPase Ca++ transporting ubiquitous antibody|Calcium pump 3 antibody|Calcium translocating P type ATPase antibody|Sarco/endoplasmic reticulum Ca2+ ATPase antibody|Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 antibody|SERCA 3 antibody|SERCA3 antibody|SERCA3b antibody|SR Ca(2+) ATPase 3 antibody|SR Ca(2+)-ATPase 3 antibody - Gen-ID
- 489
- UniProt
- Q93084
- Pathways
- Myometrial Relaxation and Contraction, Ribonucleoside Biosynthetic Process
-