SLC7A11 Antikörper

Produktnummer ABIN635373

Produktdetails anti-SLC7A11 Antikörper

Target: SLC7A11 (Solute Carrier Family 7, (Cationic Amino Acid Transporter, Y+ System) Member 11 (SLC7A11))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC7A11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC7 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC7A11 Blocking Peptide, catalog no. 33R-4402, is also available for use as a blocking control in assays to test for specificity of this SLC7A11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC7A11

Target: SLC7A11 (Solute Carrier Family 7, (Cationic Amino Acid Transporter, Y+ System) Member 11 (SLC7A11))

Andere Bezeichnung: SLC7A11 (SLC7A11 Produkte)

Synonyme: SLC7A11 antikoerper, DKFZp468E122 antikoerper, CCBR1 antikoerper, xCT antikoerper, 9930009M05Rik antikoerper, AI451155 antikoerper, sut antikoerper, solute carrier family 7 member 11 antikoerper, solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 antikoerper, solute carrier family 7 (cationic amino acid transporter, y+ system), member 11 antikoerper, SLC7A11 antikoerper, Slc7a11 antikoerper

Hintergrund: SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.

Molekulargewicht: 55 kDa (MW of target protein)