SLC16A1 Antikörper
-
- Target Alle SLC16A1 Antikörper anzeigen
- SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC16A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC16 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL
- Top Product
- Discover our top product SLC16A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC16A1 Blocking Peptide, catalog no. 33R-2496, is also available for use as a blocking control in assays to test for specificity of this SLC16A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))
- Andere Bezeichnung
- SLC16A1 (SLC16A1 Produkte)
- Synonyme
- HHF7 antikoerper, MCT antikoerper, MCT1 antikoerper, MCT1a antikoerper, cb517 antikoerper, zgc:55682 antikoerper, slc16a1 antikoerper, MGC52993 antikoerper, SLC16A1 antikoerper, DKFZp469B1212 antikoerper, AL022710 antikoerper, Mct1 antikoerper, RATMCT1 antikoerper, RNMCT1 antikoerper, solute carrier family 16 member 1 antikoerper, solute carrier family 16 (monocarboxylate transporter), member 1b antikoerper, solute carrier family 16 member 1 S homeolog antikoerper, solute carrier family 16 (monocarboxylic acid transporters), member 1 antikoerper, SLC16A1 antikoerper, slc16a1b antikoerper, slc16a1.S antikoerper, Slc16a1 antikoerper
- Hintergrund
- SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes.
- Molekulargewicht
- 54 kDa (MW of target protein)
- Pathways
- Warburg Effekt
-