SLC6A1 Antikörper

Produktnummer ABIN635367

Produktdetails anti-SLC6A1 Antikörper

Target: SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC6A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC6 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC6A1 Blocking Peptide, catalog no. 33R-1650, is also available for use as a blocking control in assays to test for specificity of this SLC6A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC6A1

Target: SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))

Andere Bezeichnung: SLC6A1 (GAT1 Produkte)

Synonyme: GABATHG antikoerper, GABATR antikoerper, GAT1 antikoerper, A730043E01 antikoerper, GAT-1 antikoerper, Gabt antikoerper, Gabt1 antikoerper, Gat1 antikoerper, XT-1 antikoerper, Xtrp1 antikoerper, si:ch211-280e18.1 antikoerper, si:dkey-164m14.1 antikoerper, slc6a1 antikoerper, solute carrier family 6 member 1 antikoerper, solute carrier family 6 (neurotransmitter transporter, GABA), member 1 antikoerper, solute carrier family 6 (neurotransmitter transporter, GABA), member 1, like antikoerper, GABA neurotransmitter transporter 1 antikoerper, SLC6A1 antikoerper, Slc6a1 antikoerper, slc6a1l antikoerper, slc6a1 antikoerper

Hintergrund: SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.

Molekulargewicht: 67 kDa (MW of target protein)