SLC6A1 Antikörper
-
- Target Alle SLC6A1 (GAT1) Antikörper anzeigen
- SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC6A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC6 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT
- Top Product
- Discover our top product GAT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC6A1 Blocking Peptide, catalog no. 33R-1650, is also available for use as a blocking control in assays to test for specificity of this SLC6A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC6A1 (GAT1) (GABA Transporter 1 (GAT1))
- Andere Bezeichnung
- SLC6A1 (GAT1 Produkte)
- Synonyme
- GABATHG antikoerper, GABATR antikoerper, GAT1 antikoerper, A730043E01 antikoerper, GAT-1 antikoerper, Gabt antikoerper, Gabt1 antikoerper, Gat1 antikoerper, XT-1 antikoerper, Xtrp1 antikoerper, si:ch211-280e18.1 antikoerper, si:dkey-164m14.1 antikoerper, slc6a1 antikoerper, solute carrier family 6 member 1 antikoerper, solute carrier family 6 (neurotransmitter transporter, GABA), member 1 antikoerper, solute carrier family 6 (neurotransmitter transporter, GABA), member 1, like antikoerper, GABA neurotransmitter transporter 1 antikoerper, SLC6A1 antikoerper, Slc6a1 antikoerper, slc6a1l antikoerper, slc6a1 antikoerper
- Hintergrund
- SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine.
- Molekulargewicht
- 67 kDa (MW of target protein)
-