B3GAT3 Antikörper
-
- Target Alle B3GAT3 Antikörper anzeigen
- B3GAT3 (beta-1,3-Glucuronyltransferase 3 (Glucuronosyltransferase I) (B3GAT3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser B3GAT3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- B3 GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY
- Top Product
- Discover our top product B3GAT3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
B3GAT3 Blocking Peptide, catalog no. 33R-7265, is also available for use as a blocking control in assays to test for specificity of this B3GAT3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 AT3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GAT3 (beta-1,3-Glucuronyltransferase 3 (Glucuronosyltransferase I) (B3GAT3))
- Andere Bezeichnung
- B3GAT3 (B3GAT3 Produkte)
- Synonyme
- GLCATI antikoerper, 2810405M13Rik antikoerper, GlcUAT-I antikoerper, Glcat-i antikoerper, beta-1,3-glucuronyltransferase 3 antikoerper, beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) antikoerper, B3GAT3 antikoerper, B3gat3 antikoerper
- Hintergrund
- The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-