Dysferlin Antikörper

Produktnummer ABIN635272

Produktdetails anti-Dysferlin Antikörper

Target: Dysferlin (DYSF)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Dysferlin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DYSF antibody was raised using a synthetic peptide corresponding to a region with amino acids SRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWGLRNMK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DYSF Blocking Peptide, catalog no. 33R-8757, is also available for use as a blocking control in assays to test for specificity of this DYSF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYSF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Dysferlin

Target: Dysferlin (DYSF)

Andere Bezeichnung: DYSF (DYSF Produkte)

Synonyme: DYSF antikoerper, fb73b05 antikoerper, wu:fb73b05 antikoerper, si:rp71-50c18.1 antikoerper, DKFZp459E1226 antikoerper, 2310004N10Rik antikoerper, AI604795 antikoerper, D6Pas3 antikoerper, mFLJ00175 antikoerper, FER1L1 antikoerper, LGMD2B antikoerper, MMD1 antikoerper, dysferlin antikoerper, dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) antikoerper, myoferlin antikoerper, DYSF antikoerper, dysf antikoerper, LOC589501 antikoerper, Dysf antikoerper

Hintergrund: DYSF belongs to the ferlin family and is a skeletal muscle protein found associated with the sarcolemma. It is involved in muscle contraction and contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. In addition, DYSF binds caveolin-3, a skeletal muscle membrane protein which is important in the formation of caveolae. Specific mutations in this gene have been shown to cause autosomal recessive limb girdle muscular dystrophy type 2B (LGMD2B) as well as Miyoshi myopathy.

Molekulargewicht: 237 kDa (MW of target protein)