LTB Antikörper

Produktnummer ABIN635263

Produktdetails anti-LTB Antikörper

Target: LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LTB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: LTB antibody was raised using a synthetic peptide corresponding to a region with amino acids AVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LTB Blocking Peptide, catalog no. 33R-1610, is also available for use as a blocking control in assays to test for specificity of this LTB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LTB

Target: LTB (Lymphotoxin beta (TNF Superfamily, Member 3) (LTB))

Andere Bezeichnung: LTB (LTB Produkte)

Synonyme: AI662801 antikoerper, LTbeta antikoerper, Tnfc antikoerper, Tnfsf3 antikoerper, p33 antikoerper, TNFC antikoerper, TNFSF3 antikoerper, LT-b antikoerper, LT-beta antikoerper, TNF-C antikoerper, lymphotoxin B antikoerper, lymphotoxin beta antikoerper, Ltb antikoerper, LTB antikoerper

Hintergrund: Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1/beta 2 complex (e.g. 1 molecule alpha/2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg