CLN6 Antikörper (Middle Region)
-
- Target Alle CLN6 Antikörper anzeigen
- CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CLN6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CLN6 antibody was raised against the middle region of CLN6
- Aufreinigung
- Affinity purified
- Immunogen
- CLN6 antibody was raised using the middle region of CLN6 corresponding to a region with amino acids LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL
- Top Product
- Discover our top product CLN6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CLN6 Blocking Peptide, catalog no. 33R-5287, is also available for use as a blocking control in assays to test for specificity of this CLN6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLN6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))
- Andere Bezeichnung
- CLN6 (CLN6 Produkte)
- Synonyme
- 1810065L06Rik antikoerper, AW743417 antikoerper, D9Bwg1455e antikoerper, nclf antikoerper, CLN4A antikoerper, HsT18960 antikoerper, cln6 antikoerper, zgc:103565 antikoerper, ceroid-lipofuscinosis, neuronal 6 antikoerper, CLN6, transmembrane ER protein antikoerper, CLN6, transmembrane ER protein S homeolog antikoerper, ceroid-lipofuscinosis, neuronal 6, late infantile, variant antikoerper, CLN6, transmembrane ER protein a antikoerper, Cln6 antikoerper, CLN6 antikoerper, cln6.S antikoerper, cln6a antikoerper
- Hintergrund
- CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-