WNT7B Antikörper (Middle Region)

Produktnummer ABIN635046

Produktdetails anti-WNT7B Antikörper

Target: WNT7B (Wingless-Type MMTV Integration Site Family, Member 7B (WNT7B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT7B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WNT7 B antibody was raised against the middle region of WNT7

Aufreinigung: Affinity purified

Immunogen: WNT7 B antibody was raised using the middle region of WNT7 corresponding to a region with amino acids WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT7B Blocking Peptide, catalog no. 33R-10029, is also available for use as a blocking control in assays to test for specificity of this WNT7B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT7B

Target: WNT7B (Wingless-Type MMTV Integration Site Family, Member 7B (WNT7B))

Andere Bezeichnung: WNT7B (WNT7B Produkte)

Synonyme: WNT7B antikoerper, Zwnt[c] antikoerper, si:ch211-239e6.2 antikoerper, wnt7 antikoerper, wnt7b antikoerper, wnt[c] antikoerper, Xwnt-7B antikoerper, Xwnt7B antikoerper, wnt-7b antikoerper, Wnt-7b antikoerper, xwnt7b antikoerper, protein Wnt-7b antikoerper, wingless-type MMTV integration site family, member 7Ba antikoerper, Wnt family member 7B antikoerper, wingless-type MMTV integration site family, member 7B antikoerper, Wnt family member 7B L homeolog antikoerper, LOC525135 antikoerper, wnt7ba antikoerper, WNT7B antikoerper, wnt7b antikoerper, Wnt7b antikoerper, wnt7b.L antikoerper

Hintergrund: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: WNT Signalweg