COX10 Antikörper (Middle Region)
-
- Target Alle COX10 Antikörper anzeigen
- COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COX10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- COX10 antibody was raised against the middle region of COX10
- Aufreinigung
- Affinity purified
- Immunogen
- COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG
- Top Product
- Discover our top product COX10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
COX10 Blocking Peptide, catalog no. 33R-1421, is also available for use as a blocking control in assays to test for specificity of this COX10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))
- Andere Bezeichnung
- COX10 (COX10 Produkte)
- Synonyme
- 2410004F01Rik antikoerper, AU042636 antikoerper, im:7145568 antikoerper, im:7157205 antikoerper, wu:fb18a03 antikoerper, F4I1.50 antikoerper, F4I1_50 antikoerper, cytochrome c oxidase 10 antikoerper, Cox10 antikoerper, cytochrome c oxidase assembly protein 10 antikoerper, COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor antikoerper, COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor L homeolog antikoerper, COX10, heme A:farnesyltransferase cytochrome c oxidase assembly factor antikoerper, cytochrome c oxidase 10 antikoerper, protoheme IX farnesyltransferase, mitochondrial antikoerper, Cox10 antikoerper, cox10 antikoerper, cox10.L antikoerper, COX10 antikoerper, LOC100732273 antikoerper
- Hintergrund
- Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is a heme A farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX.
- Molekulargewicht
- 49 kDa (MW of target protein)
-