COX10 Antikörper (Middle Region)

Produktnummer ABIN635038

Produktdetails anti-COX10 Antikörper

Target: COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COX10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: COX10 antibody was raised against the middle region of COX10

Aufreinigung: Affinity purified

Immunogen: COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COX10 Blocking Peptide, catalog no. 33R-1421, is also available for use as a blocking control in assays to test for specificity of this COX10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COX10

Target: COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))

Andere Bezeichnung: COX10 (COX10 Produkte)

Synonyme: 2410004F01Rik antikoerper, AU042636 antikoerper, im:7145568 antikoerper, im:7157205 antikoerper, wu:fb18a03 antikoerper, F4I1.50 antikoerper, F4I1_50 antikoerper, cytochrome c oxidase 10 antikoerper, Cox10 antikoerper, cytochrome c oxidase assembly protein 10 antikoerper, COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor antikoerper, COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor L homeolog antikoerper, COX10, heme A:farnesyltransferase cytochrome c oxidase assembly factor antikoerper, cytochrome c oxidase 10 antikoerper, protoheme IX farnesyltransferase, mitochondrial antikoerper, Cox10 antikoerper, cox10 antikoerper, cox10.L antikoerper, COX10 antikoerper, LOC100732273 antikoerper

Hintergrund: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is a heme A farnesyltransferase, which is not a structural subunit but required for the expression of functional COX and functions in the maturation of the heme A prosthetic group of COX.

Molekulargewicht: 49 kDa (MW of target protein)