M-CSF/CSF1 Antikörper
-
- Target Alle M-CSF/CSF1 (CSF1) Antikörper anzeigen
- M-CSF/CSF1 (CSF1) (Colony Stimulating Factor 1 (Macrophage) (CSF1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser M-CSF/CSF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CSF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP
- Top Product
- Discover our top product CSF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CSF1 Blocking Peptide, catalog no. 33R-5719, is also available for use as a blocking control in assays to test for specificity of this CSF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- M-CSF/CSF1 (CSF1) (Colony Stimulating Factor 1 (Macrophage) (CSF1))
- Andere Bezeichnung
- CSF1 (CSF1 Produkte)
- Synonyme
- CSF-1 antikoerper, MCSF antikoerper, C87615 antikoerper, Csfm antikoerper, op antikoerper, csf1-1 antikoerper, zgc:172186 antikoerper, CSF1 antikoerper, csf1-2 antikoerper, zgc:158436 antikoerper, colony stimulating factor 1 antikoerper, colony stimulating factor 1 (macrophage) antikoerper, colony stimulating factor 1a (macrophage) antikoerper, macrophage colony-stimulating factor 1 antikoerper, macrophage colony stimulating factor antikoerper, colony stimulating factor 1b (macrophage) antikoerper, CSF1 antikoerper, Csf1 antikoerper, csf1a antikoerper, LOC396599 antikoerper, LOC100860895 antikoerper, csf1b antikoerper
- Hintergrund
- CSF1 is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- RTK Signalweg
-