SLC32A1 Antikörper

Produktnummer ABIN635012

Produktdetails anti-SLC32A1 Antikörper

Target: SLC32A1 (Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC32A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC32 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC32A1 Blocking Peptide, catalog no. 33R-3196, is also available for use as a blocking control in assays to test for specificity of this SLC32A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC32A1

Target: SLC32A1 (Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1))

Andere Bezeichnung: SLC32A1 (SLC32A1 Produkte)

Synonyme: VGAT antikoerper, VIAAT antikoerper, vGAT antikoerper, Ci-vGAT antikoerper, slc32a1 antikoerper, viaat antikoerper, MGC68938 antikoerper, vgat antikoerper, xVIAAT antikoerper, R75019 antikoerper, Viaat antikoerper, CG8394 antikoerper, CG8394.2 antikoerper, Dmel\\CG8394 antikoerper, Vgat antikoerper, zgc:158324 antikoerper, solute carrier family 32 member 1 antikoerper, vesicular GABA transporter antikoerper, solute carrier family 32 member 1 S homeolog antikoerper, vesicular inhibitory amino acid transporter antikoerper, Vesicular inhibitory amino acid transporter antikoerper, solute carrier family 32 (GABA vesicular transporter), member 1 antikoerper, Vesicular GABA Transporter antikoerper, SLC32A1 antikoerper, vgat antikoerper, Bm1_20950 antikoerper, slc32a1.S antikoerper, slc32a1 antikoerper, CpipJ_CPIJ002704 antikoerper, viaat antikoerper, Slc32a1 antikoerper, VGAT antikoerper, Tsp_04599 antikoerper

Hintergrund: SLC32A1 is involved in the uptake of GABA and glycine into the synaptic vesicles.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Proton Transport