ATP2B3 Antikörper (N-Term)
-
- Target Alle ATP2B3 Antikörper anzeigen
- ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP2B3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ATP2 B3 antibody was raised against the N terminal of ATP2 3
- Aufreinigung
- Affinity purified
- Immunogen
- ATP2 B3 antibody was raised using the N terminal of ATP2 3 corresponding to a region with amino acids AEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQ
- Top Product
- Discover our top product ATP2B3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATP2B3 Blocking Peptide, catalog no. 33R-1117, is also available for use as a blocking control in assays to test for specificity of this ATP2B3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))
- Andere Bezeichnung
- ATP2B3 (ATP2B3 Produkte)
- Synonyme
- PMCA3 antikoerper, PMCA3a antikoerper, SCAX1 antikoerper, atp2b3 antikoerper, pmca3a antikoerper, zgc:92885 antikoerper, 6430519O13Rik antikoerper, Pmca3 antikoerper, ATPase plasma membrane Ca2+ transporting 3 antikoerper, ATPase, Ca++ transporting, plasma membrane 3a antikoerper, ATPase, Ca++ transporting, plasma membrane 3 antikoerper, plasma membrane calcium-transporting ATPase 2 antikoerper, ATP2B3 antikoerper, atp2b3a antikoerper, Atp2b3 antikoerper, atp2b3 antikoerper, LOC100639471 antikoerper
- Hintergrund
- ATP2B3 gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. ATP2B3 is the plasma membrane calcium ATPase isoform 3.
- Molekulargewicht
- 134 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-