PLGRKT Antikörper (Middle Region)
-
- Target Alle PLGRKT Antikörper anzeigen
- PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLGRKT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C9 ORF46 antibody was raised against the middle region of C9 rf46
- Aufreinigung
- Affinity purified
- Immunogen
- C9 ORF46 antibody was raised using the middle region of C9 rf46 corresponding to a region with amino acids AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL
- Top Product
- Discover our top product PLGRKT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C9ORF46 Blocking Peptide, catalog no. 33R-1270, is also available for use as a blocking control in assays to test for specificity of this C9ORF46 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF46 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLGRKT (Plasminogen Receptor, C-Terminal Lysine Transmembrane Protein (PLGRKT))
- Andere Bezeichnung
- C9ORF46 (PLGRKT Produkte)
- Synonyme
- C9orf46 antikoerper, MDS030 antikoerper, PLG-RKT antikoerper, Plg-R(KT) antikoerper, RGD1306839 antikoerper, 1110007H22Rik antikoerper, 5033414D02Rik antikoerper, AI852040 antikoerper, Plg-RKT antikoerper, plasminogen receptor with a C-terminal lysine antikoerper, plasminogen receptor, C-terminal lysine transmembrane protein antikoerper, PLGRKT antikoerper, Plgrkt antikoerper
- Hintergrund
- The function of C9orf46 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 17 kDa (MW of target protein)
-