ATP1B1 Antikörper (Middle Region)
-
- Target Alle ATP1B1 Antikörper anzeigen
- ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP1B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ATP1 B1 antibody was raised against the middle region of ATP1 1
- Aufreinigung
- Affinity purified
- Immunogen
- ATP1 B1 antibody was raised using the middle region of ATP1 1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL
- Top Product
- Discover our top product ATP1B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATP1B1 Blocking Peptide, catalog no. 33R-9698, is also available for use as a blocking control in assays to test for specificity of this ATP1B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP1B1 (ATPase, Na+/K+ Transporting, beta 1 Polypeptide (ATP1B1))
- Andere Bezeichnung
- ATP1B1 (ATP1B1 Produkte)
- Synonyme
- ATP1B antikoerper, Atp4b antikoerper, Atpb antikoerper, Atpb-1 antikoerper, NKbeta1 antikoerper, ATPBS antikoerper, atp1b1 antikoerper, atp1b1a antikoerper, cb710 antikoerper, ATPase Na+/K+ transporting subunit beta 1 antikoerper, ATPase, Na+/K+ transporting, beta 1 polypeptide antikoerper, ATPase beta chain antikoerper, ATP synthase CF1 beta subunit antikoerper, ATPase Na+/K+ transporting subunit beta 1 S homeolog antikoerper, ATPase, Na+/K+ transporting, beta 1b polypeptide antikoerper, ATP1B1 antikoerper, Atp1b1 antikoerper, atpB antikoerper, atp1b1.S antikoerper, atp1b1b antikoerper
- Hintergrund
- ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle.
- Molekulargewicht
- 35 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis, Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interaktom
-