Patched 2 Antikörper

Produktnummer ABIN634929

Produktdetails anti-Patched 2 Antikörper

Target: Patched 2 (PTCH2)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Patched 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTCH2 Blocking Peptide, catalog no. 33R-4790, is also available for use as a blocking control in assays to test for specificity of this PTCH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Patched 2

Target: Patched 2 (PTCH2)

Andere Bezeichnung: PTCH2 (PTCH2 Produkte)

Synonyme: PTC2 antikoerper, ptc2 antikoerper, Ptch1 antikoerper, ptc-2 antikoerper, xptc-2 antikoerper, xptch-2 antikoerper, patched-2 antikoerper, ptch2 antikoerper, ptc-1 antikoerper, ptc1 antikoerper, ptch1 antikoerper, patched 2 antikoerper, patched 2 S homeolog antikoerper, patched 2 L homeolog antikoerper, PTCH2 antikoerper, Ptch2 antikoerper, ptch2.S antikoerper, ptch2.L antikoerper, ptch2 antikoerper

Hintergrund: PTCH2 is a member of the patched protein family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. The gene encoding PTCH2 is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors.

Molekulargewicht: 130 kDa (MW of target protein)

Pathways: Hedgehog Signalweg