RNF144B Antikörper (Middle Region)

Produktnummer ABIN634924

Produktdetails anti-RNF144B Antikörper

Target: RNF144B (Ring Finger Protein 144B (RNF144B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF144B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF144 B antibody was raised against the middle region of RNF144

Aufreinigung: Affinity purified

Immunogen: RNF144 B antibody was raised using the middle region of RNF144 corresponding to a region with amino acids KHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF144B Blocking Peptide, catalog no. 33R-4424, is also available for use as a blocking control in assays to test for specificity of this RNF144B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF140 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF144B

Target: RNF144B (Ring Finger Protein 144B (RNF144B))

Andere Bezeichnung: RNF144B (RNF144B Produkte)

Synonyme: IBRDC2 antikoerper, PIR2 antikoerper, bA528A10.3 antikoerper, p53RFP antikoerper, BC025007 antikoerper, E130105P19Rik antikoerper, Ibrdc2 antikoerper, Pir2 antikoerper, ring finger protein 144B antikoerper, RNF144B antikoerper, Rnf144b antikoerper

Hintergrund: RNF144B is an E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2.

Molekulargewicht: 34 kDa (MW of target protein)