ATP2A1/SERCA1 Antikörper (N-Term)

Produktnummer ABIN634834

Produktdetails anti-ATP2A1/SERCA1 Antikörper

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP2A1/SERCA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP2 A1 antibody was raised against the N terminal of ATP2 1

Aufreinigung: Affinity purified

Immunogen: ATP2 A1 antibody was raised using the N terminal of ATP2 1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP2A1 Blocking Peptide, catalog no. 33R-5884, is also available for use as a blocking control in assays to test for specificity of this ATP2A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP2A1/SERCA1

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Andere Bezeichnung: ATP2A1 (ATP2A1 Produkte)

Synonyme: cb279 antikoerper, serca antikoerper, serca1 antikoerper, wu:cegs655 antikoerper, wu:fb17h11 antikoerper, wu:fb19b10 antikoerper, zgc:92110 antikoerper, ATP2A1 antikoerper, atp2a antikoerper, atp2a2 antikoerper, atp2b antikoerper, ca-p60a antikoerper, dar antikoerper, serca2 antikoerper, SERCA1 antikoerper, ATP2A3 antikoerper, SERCA1a antikoerper, Serca1 antikoerper, ATP2A antikoerper, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 antikoerper, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 antikoerper, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog antikoerper, atp2a1 antikoerper, ATP2A1 antikoerper, atp2a2.S antikoerper, Atp2a1 antikoerper

Hintergrund: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells.

Molekulargewicht: 109 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process