ATP2A1/SERCA1 Antikörper (N-Term)

Produktnummer ABIN3030066

Produktdetails anti-ATP2A1/SERCA1 Antikörper

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP2A1/SERCA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity

Immunogen: An amino acid sequence from the N-terminus of human ATP2A1 (MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN) was used as the immunogen for this ATP2A1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: The stated application concentrations are suggested starting amounts. Titration of the ATP2A1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ATP2A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ATP2A1/SERCA1

Target: ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))

Andere Bezeichnung: ATP2A1 (ATP2A1 Produkte)

Synonyme: cb279 antikoerper, serca antikoerper, serca1 antikoerper, wu:cegs655 antikoerper, wu:fb17h11 antikoerper, wu:fb19b10 antikoerper, zgc:92110 antikoerper, ATP2A1 antikoerper, atp2a antikoerper, atp2a2 antikoerper, atp2b antikoerper, ca-p60a antikoerper, dar antikoerper, serca2 antikoerper, SERCA1 antikoerper, ATP2A3 antikoerper, SERCA1a antikoerper, Serca1 antikoerper, ATP2A antikoerper, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 antikoerper, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 antikoerper, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog antikoerper, atp2a1 antikoerper, ATP2A1 antikoerper, atp2a2.S antikoerper, Atp2a1 antikoerper

Hintergrund: SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

Gen-ID: 487

Pathways: Ribonucleoside Biosynthetic Process