ATP2A1/SERCA1 Antikörper (N-Term)
-
- Target Alle ATP2A1/SERCA1 (ATP2A1) Antikörper anzeigen
- ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
-
Bindungsspezifität
- AA 1-32, N-Term
-
Reaktivität
- Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP2A1/SERCA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequenz
- MEAAHAKTTE ECLAYFGVSE TTGLTPDQVK RN
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human SERCA1 ATPase (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ATP2A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ATP2A1/SERCA1 (ATP2A1) (ATPase, Ca++ Transporting, Cardiac Muscle, Fast Twitch 1 (ATP2A1))
- Andere Bezeichnung
- ATP2A1 (ATP2A1 Produkte)
- Synonyme
- cb279 antikoerper, serca antikoerper, serca1 antikoerper, wu:cegs655 antikoerper, wu:fb17h11 antikoerper, wu:fb19b10 antikoerper, zgc:92110 antikoerper, ATP2A1 antikoerper, atp2a antikoerper, atp2a2 antikoerper, atp2b antikoerper, ca-p60a antikoerper, dar antikoerper, serca2 antikoerper, SERCA1 antikoerper, ATP2A3 antikoerper, SERCA1a antikoerper, Serca1 antikoerper, ATP2A antikoerper, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 antikoerper, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 antikoerper, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 S homeolog antikoerper, atp2a1 antikoerper, ATP2A1 antikoerper, atp2a2.S antikoerper, Atp2a1 antikoerper
- Hintergrund
-
SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.
Synonyms: fast twitch skeletal muscle isoform antibody|AT2A1_HUMAN antibody|ATP2A antibody|ATP2A1 antibody|ATPase Ca++ transporting cardiac muscle fast twitch 1 antibody|ATPase Ca++ transporting fast twitch 1 antibody|ATPase, Ca(2+)-transporting fast twitch 1 antibody|Calcium pump 1 antibody|Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform antibody|Calcium-transporting ATPase sarcoplasmic reticulum type antibody|Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody|Fast skeletal muscle SR calcium ATPase antibody|OTTHUMP00000162561 antibody|OTTHUMP00000162562 antibody|Sarcoendoplasmic reticulum calcium ATPase antibody|Sarcoplasmic reticulum Ca(2+)-ATPase 1 antibody|Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 antibody|SERCA 1 antibody|SERCA1 antibody|SERCA1 truncated isoform, included antibody|SR Ca(2+) ATPase 1 antibody|SR Ca(2+)-ATPase 1 antibody - Gen-ID
- 487
- UniProt
- O14983
- Pathways
- Ribonucleoside Biosynthetic Process
-