IL-4 Antikörper (Middle Region)
-
- Target Alle IL-4 (IL4) Antikörper anzeigen
- IL-4 (IL4) (Interleukin 4 (IL4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL-4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL4 antibody was raised against the middle region of IL4
- Aufreinigung
- Affinity purified
- Immunogen
- IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC
- Top Product
- Discover our top product IL4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL4 Blocking Peptide, catalog no. 33R-9363, is also available for use as a blocking control in assays to test for specificity of this IL4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL-4 (IL4) (Interleukin 4 (IL4))
- Andere Bezeichnung
- IL4 (IL4 Produkte)
- Synonyme
- IL4 antikoerper, IL-4 antikoerper, BCGF-1 antikoerper, BCGF1 antikoerper, BSF-1 antikoerper, BSF1 antikoerper, Il-4 antikoerper, Il4e12 antikoerper, IL2 antikoerper, interleukin 4 antikoerper, IL4 antikoerper, Il4 antikoerper
- Hintergrund
- IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine.
- Molekulargewicht
- 15 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Proton Transport, Activated T Cell Proliferation
-