BDNF Antikörper (Middle Region)
-
- Target Alle BDNF Antikörper anzeigen
- BDNF (Brain-Derived Neurotrophic Factor (BDNF))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BDNF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BDNF antibody was raised against the middle region of BDNF
- Aufreinigung
- Affinity purified
- Immunogen
- BDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
- Top Product
- Discover our top product BDNF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BDNF Blocking Peptide, catalog no. 33R-2813, is also available for use as a blocking control in assays to test for specificity of this BDNF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDNF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BDNF (Brain-Derived Neurotrophic Factor (BDNF))
- Andere Bezeichnung
- BDNF (BDNF Produkte)
- Synonyme
- ANON2 antikoerper, BULN2 antikoerper, bdnf-A antikoerper, BDNF antikoerper, bdnf antikoerper, brain derived neurotrophic factor antikoerper, brain-derived neurotrophic factor antikoerper, brain-derived neurotrophic factor L homeolog antikoerper, brain-derived neurotrophic factor S homeolog antikoerper, BDNF antikoerper, Bdnf antikoerper, bdnf antikoerper, bdnf.L antikoerper, bdnf.S antikoerper
- Hintergrund
- BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- RTK Signalweg, Synaptic Membrane, Feeding Behaviour, Dicarboxylic Acid Transport, Regulation of long-term Neuronal Synaptic Plasticity
-