Ephrin B1 Antikörper (Middle Region)

Produktnummer ABIN634690

Produktdetails anti-Ephrin B1 Antikörper

Target: Ephrin B1 (EFNB1)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ephrin B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ephrin-B1 antibody was raised against the middle region of EFNB1

Aufreinigung: Affinity purified

Immunogen: Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ephrin-B1 Blocking Peptide, catalog no. 33R-8768, is also available for use as a blocking control in assays to test for specificity of this Ephrin-B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFNB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ephrin B1

Target: Ephrin B1 (EFNB1)

Andere Bezeichnung: Ephrin-B1 (EFNB1 Produkte)

Synonyme: EFNB1 antikoerper, LERK2 antikoerper, Cek5-L antikoerper, EFL-3 antikoerper, Elk-L antikoerper, Epl2 antikoerper, Eplg2 antikoerper, LERK-2 antikoerper, Lerk2 antikoerper, Stra1 antikoerper, CFND antikoerper, CFNS antikoerper, EFL3 antikoerper, EPLG2 antikoerper, cfnd antikoerper, cfns antikoerper, efl3 antikoerper, efnb1-A antikoerper, ephrinB1 antikoerper, eplg2 antikoerper, lerk2 antikoerper, ephrin B1 antikoerper, ephrin-B1 antikoerper, ephrin-B1 L homeolog antikoerper, EFNB1 antikoerper, Efnb1 antikoerper, efnb1 antikoerper, efnb1.L antikoerper

Hintergrund: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: RTK Signalweg