Ephrin B1 Antikörper (Middle Region)

Produktnummer ABIN634690

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Ephrin B1 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für Ephrin B1 Antikörper (Middle Region) (ABIN634690)

Target: Ephrin B1 (EFNB1)

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ephrin B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Ephrin B1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Ephrin-B1 antibody was raised against the middle region of EFNB1

Aufreinigung: Affinity purified

Immunogen: Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ephrin-B1 Blocking Peptide, (ABIN5613384), is also available for use as a blocking control in assays to test for specificity of this Ephrin-B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFNB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ephrin B1

Target: Ephrin B1 (EFNB1)

Andere Bezeichnung: Ephrin-B1

Hintergrund: The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: RTK Signalweg