GJB6 Antikörper (Middle Region)

Produktnummer ABIN634670

Produktdetails anti-GJB6 Antikörper

Target: GJB6 (Gap Junction Protein, beta 6, 30kDa (GJB6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJB6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJB6 antibody was raised against the middle region of GJB6

Aufreinigung: Affinity purified

Immunogen: GJB6 antibody was raised using the middle region of GJB6 corresponding to a region with amino acids CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJB6 Blocking Peptide, catalog no. 33R-1835, is also available for use as a blocking control in assays to test for specificity of this GJB6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJB6

Target: GJB6 (Gap Junction Protein, beta 6, 30kDa (GJB6))

Andere Bezeichnung: GJB6 (GJB6 Produkte)

Synonyme: connexin-26 antikoerper, cx26 antikoerper, cx30 antikoerper, dfna3 antikoerper, dfna3a antikoerper, dfnb1 antikoerper, dfnb1a antikoerper, ed2 antikoerper, edh antikoerper, gjb6 antikoerper, hed antikoerper, nsrd1 antikoerper, ppk antikoerper, AA958971 antikoerper, Cx30 antikoerper, D14Bwg0506e antikoerper, CX30 antikoerper, DFNA3 antikoerper, DFNA3B antikoerper, DFNB1B antikoerper, ECTD2 antikoerper, ED2 antikoerper, EDH antikoerper, HED antikoerper, HED2 antikoerper, CX31 antikoerper, connexin 30 antikoerper, gap junction protein beta 2 antikoerper, gap junction protein beta 6 antikoerper, gap junction protein, beta 6 antikoerper, LOC387566 antikoerper, gjb2 antikoerper, GJB6 antikoerper, Gjb6 antikoerper

Hintergrund: Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments.

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: Sensory Perception of Sound