PTK2B Antikörper (C-Term)
-
- Target Alle PTK2B Antikörper anzeigen
- PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PTK2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PTK2 B antibody was raised against the C terminal of PTK2
- Aufreinigung
- Affinity purified
- Immunogen
- PTK2 B antibody was raised using the C terminal of PTK2 corresponding to a region with amino acids KSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMEL
- Top Product
- Discover our top product PTK2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PTK2B Blocking Peptide, catalog no. 33R-4661, is also available for use as a blocking control in assays to test for specificity of this PTK2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))
- Andere Bezeichnung
- PTK2B (PTK2B Produkte)
- Synonyme
- CADTK antikoerper, CAKB antikoerper, FADK2 antikoerper, FAK2 antikoerper, PKB antikoerper, PTK antikoerper, PYK2 antikoerper, RAFTK antikoerper, CAKbeta antikoerper, E430023O05Rik antikoerper, Raftk antikoerper, Pyk2 antikoerper, fak1b antikoerper, ptk2.2 antikoerper, ptk2b antikoerper, si:ch1073-355e8.1 antikoerper, protein tyrosine kinase 2 beta antikoerper, PTK2 protein tyrosine kinase 2 beta antikoerper, protein tyrosine kinase 2aa antikoerper, PTK2B antikoerper, Ptk2b antikoerper, ptk2aa antikoerper
- Hintergrund
- PTK2B encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity.
- Molekulargewicht
- 116 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Cellular Glucan Metabolic Process, Cell-Cell Junction Organization, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Positive Regulation of fat Cell Differentiation, VEGF Signaling
-