PPP2R1B Antikörper
-
- Target Alle PPP2R1B Antikörper anzeigen
- PPP2R1B (Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP2R1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ
- Top Product
- Discover our top product PPP2R1B Primärantikörper
-
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) (AA 402-601), (Regulatory Subunit A) antibody
PPP2R1B Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) antibodyPPP2R1B Reaktivität: Human, Maus, Ratte WB, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) (C-Term) antibodyPPP2R1B Reaktivität: Human, Maus, Ratte WB, IHC, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) antibodyPPP2R1B Reaktivität: Human, Maus, Ratte WB, IHC (p) Wirt: Maus Monoclonal 6C6 unconjugated
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) (C-Term) antibodyPPP2R1B Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) (C-Term) antibodyPPP2R1B Reaktivität: Human, Maus, Ratte WB, IHC, ELISA, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) (N-Term) antibodyPPP2R1B Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB51483 unconjugated
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) (AA 1-601) antibodyPPP2R1B Reaktivität: Human IP Wirt: Kaninchen Polyclonal unconjugated
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) (AA 1-601) antibodyPPP2R1B Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B) (AA 35-84) antibodyPPP2R1B Reaktivität: Human, Maus, Ratte, Affe, Schwein, Rind (Kuh), Pferd, Kaninchen, Meerschweinchen, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPP2R1B Blocking Peptide, catalog no. 33R-2332, is also available for use as a blocking control in assays to test for specificity of this PPP2R1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP2R1B (Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B))
- Andere Bezeichnung
- PPP2R1B (PPP2R1B Produkte)
- Synonyme
- 2410091N08Rik antikoerper, AI790395 antikoerper, PP2A-Abeta antikoerper, PR65B antikoerper, protein phosphatase 2, regulatory subunit A, beta antikoerper, protein phosphatase 2 scaffold subunit Abeta antikoerper, protein phosphatase 2 scaffold subunit A beta antikoerper, protein phosphatase 2 regulatory subunit A, beta S homeolog antikoerper, Ppp2r1b antikoerper, PPP2R1B antikoerper, ppp2r1b.S antikoerper
- Hintergrund
- This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division.
- Molekulargewicht
- 73 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signalweg, Mitotic G1-G1/S Phases, Hepatitis C, Toll-Like Receptors Cascades
-
