IFT140 Antikörper

Produktnummer ABIN634619

Produktdetails anti-IFT140 Antikörper

Target: IFT140 (Intraflagellar Transport 140 Homolog (IFT140))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFT140 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: IFT140 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFT140 Blocking Peptide, catalog no. 33R-9681, is also available for use as a blocking control in assays to test for specificity of this IFT140 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT140 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFT140

Target: IFT140 (Intraflagellar Transport 140 Homolog (IFT140))

Andere Bezeichnung: IFT140 (IFT140 Produkte)

Synonyme: zC153C20.3 antikoerper, si:ch211-153c20.3 antikoerper, gs114 antikoerper, wdtc2 antikoerper, c305c8.4 antikoerper, c380f5.1 antikoerper, AI661311 antikoerper, Tce5 antikoerper, Wdtc2 antikoerper, mKIAA0590 antikoerper, MZSDS antikoerper, WDTC2 antikoerper, c305C8.4 antikoerper, c380F5.1 antikoerper, intraflagellar transport 140 homolog (Chlamydomonas) antikoerper, intraflagellar transport 140 antikoerper, intraflagellar transport protein 140 homolog antikoerper, ift140 antikoerper, IFT140 antikoerper, LOC100636864 antikoerper, LOC100645502 antikoerper, Ift140 antikoerper

Hintergrund: IFT140 contains 9 TPR repeats and 5 WD repeats. The function of the IFT140 protein remains unknown.

Molekulargewicht: 165 kDa (MW of target protein)

Pathways: Hedgehog Signalweg