IFT140 Antikörper
-
- Target Alle IFT140 Antikörper anzeigen
- IFT140 (Intraflagellar Transport 140 Homolog (IFT140))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IFT140 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- IFT140 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF
- Top Product
- Discover our top product IFT140 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IFT140 Blocking Peptide, catalog no. 33R-9681, is also available for use as a blocking control in assays to test for specificity of this IFT140 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFT140 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFT140 (Intraflagellar Transport 140 Homolog (IFT140))
- Andere Bezeichnung
- IFT140 (IFT140 Produkte)
- Synonyme
- zC153C20.3 antikoerper, si:ch211-153c20.3 antikoerper, gs114 antikoerper, wdtc2 antikoerper, c305c8.4 antikoerper, c380f5.1 antikoerper, AI661311 antikoerper, Tce5 antikoerper, Wdtc2 antikoerper, mKIAA0590 antikoerper, MZSDS antikoerper, WDTC2 antikoerper, c305C8.4 antikoerper, c380F5.1 antikoerper, intraflagellar transport 140 homolog (Chlamydomonas) antikoerper, intraflagellar transport 140 antikoerper, intraflagellar transport protein 140 homolog antikoerper, ift140 antikoerper, IFT140 antikoerper, LOC100636864 antikoerper, LOC100645502 antikoerper, Ift140 antikoerper
- Hintergrund
- IFT140 contains 9 TPR repeats and 5 WD repeats. The function of the IFT140 protein remains unknown.
- Molekulargewicht
- 165 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg
-