RPSA/Laminin Receptor Antikörper (Middle Region)

Produktnummer ABIN634613

Produktdetails anti-RPSA/Laminin Receptor Antikörper

Target: RPSA/Laminin Receptor (RPSA) (Ribosomal Protein SA (RPSA))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPSA/Laminin Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPSA antibody was raised against the middle region of RPSA

Aufreinigung: Affinity purified

Immunogen: RPSA antibody was raised using the middle region of RPSA corresponding to a region with amino acids TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPSA Blocking Peptide, catalog no. 33R-9077, is also available for use as a blocking control in assays to test for specificity of this RPSA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPSA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPSA/Laminin Receptor

Target: RPSA/Laminin Receptor (RPSA) (Ribosomal Protein SA (RPSA))

Andere Bezeichnung: RPSA (RPSA Produkte)

Synonyme: 37LRP antikoerper, 67LR antikoerper, LBP/p40 antikoerper, LRP/LR antikoerper, LamR antikoerper, rpsa antikoerper, LamR1 antikoerper, RPSA antikoerper, LAMBR antikoerper, LAMR1 antikoerper, LBP antikoerper, LRP antikoerper, NEM/1CHD4 antikoerper, SA antikoerper, lamR antikoerper, p40 antikoerper, 67kDa antikoerper, 67lr antikoerper, AL022858 antikoerper, Lamr antikoerper, Lamr1 antikoerper, Lamrl1 antikoerper, MLR antikoerper, P40 antikoerper, P40-3 antikoerper, P40-8 antikoerper, lamr1 antikoerper, zgc:55831 antikoerper, zgc:77824 antikoerper, DMRT1 antikoerper, 40S ribosomal protein SA antikoerper, 67kD laminin receptor antikoerper, ribosomal protein SA antikoerper, rssa antikoerper, rpsa antikoerper, RPSA antikoerper, Rpsa antikoerper, LOC100144340 antikoerper

Hintergrund: RPSA is required for the assembly and/or stability of the 40S ribosomal subunit. RPSA is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. RPSA plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. RPSA may play a role in cell fate determination and tissue morphogenesis.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly