C1QB Antikörper (Middle Region)

Produktnummer ABIN634563

Produktdetails anti-C1QB Antikörper

Target: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1QB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 QB antibody was raised against the middle region of C1 B

Aufreinigung: Affinity purified

Immunogen: C1 QB antibody was raised using the middle region of C1 B corresponding to a region with amino acids PGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1QB Blocking Peptide, catalog no. 33R-7122, is also available for use as a blocking control in assays to test for specificity of this C1QB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 B antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1QB

Target: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Andere Bezeichnung: C1QB (C1QB Produkte)

Synonyme: complement C1q B chain antikoerper, complement component 1, q subcomponent, beta polypeptide antikoerper, C1QB antikoerper, C1qb antikoerper

Hintergrund: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Komplementsystem