C1QB Antikörper (C-Term)

Produktnummer ABIN634558

Produktdetails anti-C1QB Antikörper

Target: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1QB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: C1 QB antibody was raised against the C terminal of C1 B

Aufreinigung: Affinity purified

Immunogen: C1 QB antibody was raised using the C terminal of C1 B corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1QB Blocking Peptide, catalog no. 33R-1631, is also available for use as a blocking control in assays to test for specificity of this C1QB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 B antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1QB

Target: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Andere Bezeichnung: C1QB (C1QB Produkte)

Synonyme: complement C1q B chain antikoerper, complement component 1, q subcomponent, beta polypeptide antikoerper, C1QB antikoerper, C1qb antikoerper

Hintergrund: C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Komplementsystem