BAFF Antikörper

Produktnummer ABIN634541

Der Kaninchen Polyklonal anti-BAFF Antikörper wird verwendet zum Nachweis von BAFF in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für BAFF Antikörper (ABIN634541)

Target: BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BAFF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BAFF Antikörper

Aufreinigung: Affinity purified

Immunogen: TNFSF13 B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TNFSF13B Blocking Peptide, (ABIN936749), is also available for use as a blocking control in assays to test for specificity of this TNFSF13B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFSF10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BAFF

Target: BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))

Andere Bezeichnung: TNFSF13B

Hintergrund: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: NF-kappaB Signalweg, Production of Molecular Mediator of Immune Response