BAFF Antikörper
-
- Target Alle BAFF (TNFSF13B) Antikörper anzeigen
- BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BAFF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TNFSF13 B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
- Top Product
- Discover our top product TNFSF13B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TNFSF13B Blocking Peptide, catalog no. 33R-1363, is also available for use as a blocking control in assays to test for specificity of this TNFSF13B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFSF10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))
- Andere Bezeichnung
- TNFSF13B (TNFSF13B Produkte)
- Synonyme
- BAFF antikoerper, BLYS antikoerper, CD257 antikoerper, DTL antikoerper, TALL-1 antikoerper, TALL1 antikoerper, THANK antikoerper, TNFSF20 antikoerper, ZTNF4 antikoerper, BAFF-R antikoerper, BAFFR antikoerper, BROMIX antikoerper, CD268 antikoerper, CVID4 antikoerper, prolixin antikoerper, TNFSF13B antikoerper, RGD1561519 antikoerper, RGD1560810 antikoerper, BLyS antikoerper, D8Ertd387e antikoerper, zTNF4 antikoerper, 2010006P15Rik antikoerper, Baffr antikoerper, Bcmd antikoerper, Bcmd-1 antikoerper, Bcmd1 antikoerper, Lvis22 antikoerper, zgc:172115 antikoerper, TNF superfamily member 13b antikoerper, TNF receptor superfamily member 13C antikoerper, tumor necrosis factor (ligand) superfamily, member 13b antikoerper, tumor necrosis factor receptor superfamily, member 13c antikoerper, tumor necrosis factor superfamily member 13b antikoerper, TNFSF13B antikoerper, TNFRSF13C antikoerper, Tnfsf13b antikoerper, Tnfrsf13c antikoerper, tnfsf13b antikoerper
- Hintergrund
- The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- NF-kappaB Signalweg, Production of Molecular Mediator of Immune Response
-