ATP2C1 Antikörper (C-Term)

Produktnummer ABIN634534

Produktdetails anti-ATP2C1 Antikörper

Target: ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP2C1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP2 C1 antibody was raised against the C terminal of ATP2 1

Aufreinigung: Affinity purified

Immunogen: ATP2 C1 antibody was raised using the C terminal of ATP2 1 corresponding to a region with amino acids TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP2C1 Blocking Peptide, catalog no. 33R-9151, is also available for use as a blocking control in assays to test for specificity of this ATP2C1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP2C1

Target: ATP2C1 (ATPase, Ca++ Transporting, Type 2C, Member 1 (ATP2C1))

Andere Bezeichnung: ATP2C1 (ATP2C1 Produkte)

Synonyme: ATP2C1 antikoerper, ATP2C1A antikoerper, BCPM antikoerper, HHD antikoerper, PMR1 antikoerper, SPCA1 antikoerper, hSPCA1 antikoerper, Spca1 antikoerper, si:dkey-11p23.6 antikoerper, SPCA antikoerper, 1700121J11Rik antikoerper, AW061228 antikoerper, D930003G21Rik antikoerper, pmr1 antikoerper, ATPase secretory pathway Ca2+ transporting 1 antikoerper, ATPase, Ca++ transporting, type 2C, member 1 antikoerper, ATPase, Ca++-sequestering antikoerper, ATP2C1 antikoerper, atp2c1 antikoerper, Atp2c1 antikoerper

Hintergrund: ATP2C1 belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process