Angiotensin II Type-1 Receptor Antikörper (N-Term)

Produktnummer ABIN634511

Produktdetails anti-Angiotensin II Type-1 Receptor Antikörper

Target: Angiotensin II Type-1 Receptor (AGTR1) (Angiotensin II Receptor, Type 1 (AGTR1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Angiotensin II Type-1 Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AGTR1 antibody was raised against the N terminal of AGTR1

Aufreinigung: Affinity purified

Immunogen: AGTR1 antibody was raised using the N terminal of AGTR1 corresponding to a region with amino acids ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AGTR1 Blocking Peptide, catalog no. 33R-4056, is also available for use as a blocking control in assays to test for specificity of this AGTR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGTR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Angiotensin II Type-1 Receptor

Target: Angiotensin II Type-1 Receptor (AGTR1) (Angiotensin II Receptor, Type 1 (AGTR1))

Andere Bezeichnung: AGTR1 (AGTR1 Produkte)

Hintergrund: Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. AGTR1 is the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, ACE Inhibitor Pathway, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour