PRKAA1 Antikörper (Middle Region)

Produktnummer ABIN634505

Produktdetails anti-PRKAA1 Antikörper

Target: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRKAA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKAA1 antibody was raised against the middle region of PRKAA1

Aufreinigung: Affinity purified

Immunogen: PRKAA1 antibody was raised using the middle region of PRKAA1 corresponding to a region with amino acids SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKAA1 Blocking Peptide, catalog no. 33R-8915, is also available for use as a blocking control in assays to test for specificity of this PRKAA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRKAA1

Target: PRKAA1 (Protein Kinase, AMP-Activated, alpha 1 Catalytic Subunit (PRKAA1))

Andere Bezeichnung: PRKAA1 (PRKAA1 Produkte)

Synonyme: AMPK antikoerper, AMPKa1 antikoerper, cb116 antikoerper, im:7154392 antikoerper, sb:cb130 antikoerper, wu:fa94c10 antikoerper, AMPK1 antikoerper, AMPKalpha1 antikoerper, AI194361 antikoerper, AI450832 antikoerper, AL024255 antikoerper, C130083N04Rik antikoerper, ampk antikoerper, ampka1 antikoerper, PRKAA1 antikoerper, protein kinase AMP-activated catalytic subunit alpha 1 antikoerper, protein kinase, AMP-activated, alpha 1 catalytic subunit antikoerper, protein kinase, AMP-activated, alpha 1 catalytic subunit L homeolog antikoerper, PRKAA1 antikoerper, prkaa1 antikoerper, Prkaa1 antikoerper, prkaa1.L antikoerper

Hintergrund: PRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK).

Molekulargewicht: 63 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effekt