DFFB Antikörper
-
- Target Alle DFFB Antikörper anzeigen
- DFFB (DNA Fragmentation Factor, 40kDa, beta Polypeptide (Caspase-Activated DNase) (DFFB))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DFFB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DFFB antibody was raised using a synthetic peptide corresponding to a region with amino acids EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK
- Top Product
- Discover our top product DFFB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DFFB Blocking Peptide, catalog no. 33R-2821, is also available for use as a blocking control in assays to test for specificity of this DFFB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DFFB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DFFB (DNA Fragmentation Factor, 40kDa, beta Polypeptide (Caspase-Activated DNase) (DFFB))
- Andere Bezeichnung
- DFFB (DFFB Produkte)
- Synonyme
- CAD antikoerper, CPAN antikoerper, DFF-40 antikoerper, DFF2 antikoerper, DFF40 antikoerper, LOC100223514 antikoerper, 40kDa antikoerper, 5730477D02Rik antikoerper, Didff antikoerper, Cad antikoerper, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase antikoerper, DNA fragmentation factor subunit beta antikoerper, DNA fragmentation factor, beta polypeptide (caspase-activated DNase) antikoerper, DNA fragmentation factor, beta subunit antikoerper, CAD antikoerper, DFFB antikoerper, dffb antikoerper, LOC100223514 antikoerper, Dffb antikoerper
- Hintergrund
- DFFB is a nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. DFFB degrades naked DNA and induces apoptotic morphology.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Apoptose, Caspase Kaskade in der Apoptose
-