PRKRA Antikörper (N-Term)
-
- Target Alle PRKRA Antikörper anzeigen
- PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PRKRA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PRKRA antibody was raised against the N terminal of PRKRA
- Aufreinigung
- Affinity purified
- Immunogen
- PRKRA antibody was raised using the N terminal of PRKRA corresponding to a region with amino acids MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP
- Top Product
- Discover our top product PRKRA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PRKRA Blocking Peptide, catalog no. 33R-6483, is also available for use as a blocking control in assays to test for specificity of this PRKRA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKRA (Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA))
- Andere Bezeichnung
- PRKRA (PRKRA Produkte)
- Synonyme
- PRKRA antikoerper, AV120107 antikoerper, PRK antikoerper, Pact antikoerper, RAX antikoerper, lear antikoerper, DYT16 antikoerper, PACT antikoerper, im:7151758 antikoerper, zgc:162619 antikoerper, dyt16 antikoerper, pact antikoerper, prkra-a antikoerper, prkra-b antikoerper, rax antikoerper, rbpa antikoerper, protein activator of interferon induced protein kinase EIF2AK2 antikoerper, protein kinase, interferon inducible double stranded RNA dependent activator antikoerper, protein kinase, interferon-inducible double stranded RNA dependent activator antikoerper, protein activator of interferon induced protein kinase EIF2AK2 L homeolog antikoerper, PRKRA antikoerper, Prkra antikoerper, prkra antikoerper, prkra.L antikoerper
- Hintergrund
- PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Regulatorische RNA Pathways
-