G3BP1 Antikörper

Produktnummer ABIN634465

Produktdetails anti-G3BP1 Antikörper

Target: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser G3BP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: G3 BP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

G3BP1 Blocking Peptide, catalog no. 33R-7905, is also available for use as a blocking control in assays to test for specificity of this G3BP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu G3BP1

Target: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Andere Bezeichnung: G3BP1 (G3BP1 Produkte)

Synonyme: G3BP antikoerper, HDH-VIII antikoerper, fj17h05 antikoerper, zgc:56034 antikoerper, wu:fj17h05 antikoerper, g3bp antikoerper, MGC53271 antikoerper, G3BP1 antikoerper, G3bp antikoerper, RGD1310666 antikoerper, AI849976 antikoerper, B430204O07 antikoerper, C87777 antikoerper, mKIAA4115 antikoerper, G3BP stress granule assembly factor 1 antikoerper, GTPase activating protein (SH3 domain) binding protein 1 antikoerper, GTPase activating protein (SH3 domain) binding protein 1 L homeolog antikoerper, Ras-GTPase-activating protein SH3-domain-binding protein antikoerper, G3BP1 antikoerper, g3bp1 antikoerper, g3bp1.L antikoerper, LOC100304885 antikoerper, G3bp1 antikoerper

Hintergrund: This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom