OAS1 Antikörper (N-Term)
-
- Target Alle OAS1 Antikörper anzeigen
- OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OAS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OAS1 antibody was raised against the N terminal of OAS1
- Aufreinigung
- Affinity purified
- Immunogen
- OAS1 antibody was raised using the N terminal of OAS1 corresponding to a region with amino acids MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS
- Top Product
- Discover our top product OAS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OAS1 Blocking Peptide, catalog no. 33R-6228, is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))
- Andere Bezeichnung
- OAS1 (OAS1 Produkte)
- Synonyme
- OAS1 antikoerper, IFI-4 antikoerper, OIAS antikoerper, OIASI antikoerper, L3 antikoerper, Pp2a2 antikoerper, 2',5'-oligoadenylate synthetase 1 antikoerper, 2'-5'-oligoadenylate synthetase 1 antikoerper, 2'-5' oligoadenylate synthetase 1A antikoerper, protein phosphatase 2 catalytic subunit beta antikoerper, OAS1 antikoerper, Oas1a antikoerper, Ppp2cb antikoerper, Oas1 antikoerper
- Hintergrund
- This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Hepatitis C
-