OAS1 Antikörper (C-Term)

Produktnummer ABIN634457

Produktdetails anti-OAS1 Antikörper

Target: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OAS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OAS1 antibody was raised against the C terminal of OAS1

Aufreinigung: Affinity purified

Immunogen: OAS1 antibody was raised using the C terminal of OAS1 corresponding to a region with amino acids GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OAS1 Blocking Peptide, catalog no. 33R-3670, is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OAS1

Target: OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))

Andere Bezeichnung: OAS1 (OAS1 Produkte)

Synonyme: OAS1 antikoerper, IFI-4 antikoerper, OIAS antikoerper, OIASI antikoerper, L3 antikoerper, Pp2a2 antikoerper, 2',5'-oligoadenylate synthetase 1 antikoerper, 2'-5'-oligoadenylate synthetase 1 antikoerper, 2'-5' oligoadenylate synthetase 1A antikoerper, protein phosphatase 2 catalytic subunit beta antikoerper, OAS1 antikoerper, Oas1a antikoerper, Ppp2cb antikoerper, Oas1 antikoerper

Hintergrund: OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Hepatitis C