PSMB10 Antikörper
-
- Target Alle PSMB10 Antikörper anzeigen
- PSMB10 (Proteasome (Prosome, Macropain) Subunit, beta Type 10 (PSMB10))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMB10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PSMB10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG
- Top Product
- Discover our top product PSMB10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSMB10 Blocking Peptide, catalog no. 33R-2068, is also available for use as a blocking control in assays to test for specificity of this PSMB10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMB10 (Proteasome (Prosome, Macropain) Subunit, beta Type 10 (PSMB10))
- Andere Bezeichnung
- PSMB10 (PSMB10 Produkte)
- Synonyme
- Mecl-1 antikoerper, Mecl1 antikoerper, LMP10 antikoerper, MECL1 antikoerper, beta2i antikoerper, proteasome (prosome, macropain) subunit, beta type 10 antikoerper, proteasome subunit beta 10 antikoerper, Psmb10 antikoerper, PSMB10 antikoerper
- Hintergrund
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-