RAB11B Antikörper (C-Term)

Produktnummer ABIN634441

Produktdetails anti-RAB11B Antikörper

Target: RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAB11B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAB11 B antibody was raised against the C terminal of RAB11

Aufreinigung: Affinity purified

Immunogen: RAB11 B antibody was raised using the C terminal of RAB11 corresponding to a region with amino acids IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAB11B Blocking Peptide, catalog no. 33R-3953, is also available for use as a blocking control in assays to test for specificity of this RAB11B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAB11B

Target: RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))

Andere Bezeichnung: RAB11B (RAB11B Produkte)

Synonyme: zgc:92772 antikoerper, H-YPT3 antikoerper, A730055L17Rik antikoerper, rab11b antikoerper, wu:fb07g11 antikoerper, zgc:55760 antikoerper, RAB11B, member RAS oncogene family, b antikoerper, RAB11B, member RAS oncogene family antikoerper, RAB11B, member RAS oncogene family, a antikoerper, RAB11B, member RAS oncogene family, gene 1 S homeolog antikoerper, rab11bb antikoerper, RAB11B antikoerper, Rab11b antikoerper, rab11ba antikoerper, rab11b.1.S antikoerper

Hintergrund: RAB11B possesses GTPase activity.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis