NKIRAS2 Antikörper (C-Term)
-
- Target Alle NKIRAS2 Antikörper anzeigen
- NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NKIRAS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NKIRAS2 antibody was raised against the C terminal of NKIRAS2
- Aufreinigung
- Affinity purified
- Immunogen
- NKIRAS2 antibody was raised using the C terminal of NKIRAS2 corresponding to a region with amino acids VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
- Top Product
- Discover our top product NKIRAS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NKIRAS2 Blocking Peptide, catalog no. 33R-9632, is also available for use as a blocking control in assays to test for specificity of this NKIRAS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NKIRAS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NKIRAS2 (NFKB Inhibitor Interacting Ras-Like 2 (NKIRAS2))
- Andere Bezeichnung
- NKIRAS2 (NKIRAS2 Produkte)
- Synonyme
- NKIRAS2 antikoerper, KBRAS2 antikoerper, kappaB-Ras2 antikoerper, zgc:92870 antikoerper, 2410003M04Rik antikoerper, 4930527H08Rik antikoerper, D630018G21Rik antikoerper, NFKB inhibitor interacting Ras like 2 antikoerper, NFKB inhibitor interacting Ras-like 2 antikoerper, NFKB inhibitor interacting Ras like 2 L homeolog antikoerper, NFKB inhibitor interacting Ras-like protein 2 antikoerper, NKIRAS2 antikoerper, Nkiras2 antikoerper, nkiras2 antikoerper, nkiras2.L antikoerper
- Hintergrund
- NPAL2 is a multi-pass membrane protein and it belongs to the NIPA family. The exact function of NPAL2 remains unknown.
- Molekulargewicht
- 21 kDa (MW of target protein)
-