DOCK2 Antikörper (Middle Region)

Produktnummer ABIN634376

Produktdetails anti-DOCK2 Antikörper

Target: DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DOCK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DOCK2 antibody was raised against the middle region of DOCK2

Aufreinigung: Affinity purified

Immunogen: DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DOCK2 Blocking Peptide, catalog no. 33R-1320, is also available for use as a blocking control in assays to test for specificity of this DOCK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOCK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DOCK2

Target: DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))

Andere Bezeichnung: DOCK2 (DOCK2 Produkte)

Synonyme: AI662014 antikoerper, AW122239 antikoerper, CED-5 antikoerper, Hch antikoerper, MBC antikoerper, dedicator of cytokinesis 2 antikoerper, dedicator of cyto-kinesis 2 antikoerper, DOCK2 antikoerper, dock2 antikoerper, Dock2 antikoerper

Hintergrund: The DOCK2 gene encodes a hematopoietic cell-specific CDM family protein that is indispensable for lymphocyte chemotaxis.

Molekulargewicht: 212 kDa (MW of target protein)