DOCK2 Antikörper (Middle Region)
-
- Target Alle DOCK2 Antikörper anzeigen
- DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DOCK2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DOCK2 antibody was raised against the middle region of DOCK2
- Aufreinigung
- Affinity purified
- Immunogen
- DOCK2 antibody was raised using the middle region of DOCK2 corresponding to a region with amino acids ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA
- Top Product
- Discover our top product DOCK2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DOCK2 Blocking Peptide, catalog no. 33R-1320, is also available for use as a blocking control in assays to test for specificity of this DOCK2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DOCK2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DOCK2 (Dedicator of Cytokinesis 2 (DOCK2))
- Andere Bezeichnung
- DOCK2 (DOCK2 Produkte)
- Synonyme
- AI662014 antikoerper, AW122239 antikoerper, CED-5 antikoerper, Hch antikoerper, MBC antikoerper, dedicator of cytokinesis 2 antikoerper, dedicator of cyto-kinesis 2 antikoerper, DOCK2 antikoerper, dock2 antikoerper, Dock2 antikoerper
- Hintergrund
- The DOCK2 gene encodes a hematopoietic cell-specific CDM family protein that is indispensable for lymphocyte chemotaxis.
- Molekulargewicht
- 212 kDa (MW of target protein)
-