PPM1A Antikörper

Produktnummer ABIN634361

Produktdetails anti-PPM1A Antikörper

Target: PPM1A (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPM1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPM1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPM1A Blocking Peptide, catalog no. 33R-2464, is also available for use as a blocking control in assays to test for specificity of this PPM1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPM1A

Target: PPM1A (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A))

Andere Bezeichnung: PPM1A (PPM1A Produkte)

Synonyme: PP2C-ALPHA antikoerper, PP2CA antikoerper, PP2Calpha antikoerper, pp2ca1 antikoerper, ppp1r13b antikoerper, si:ch211-253p18.1 antikoerper, wu:fd42g12 antikoerper, zgc:153820 antikoerper, 2310003C21Rik antikoerper, 2900017D14Rik antikoerper, AI427932 antikoerper, AU017636 antikoerper, MMPa-2 antikoerper, MPPa-1 antikoerper, Pp2c1 antikoerper, pp2c-alpha antikoerper, pp2ca antikoerper, pp2calpha antikoerper, pp2ca2 antikoerper, protein phosphatase, Mg2+/Mn2+ dependent 1A antikoerper, protein phosphatase, Mg2+/Mn2+ dependent, 1Ab antikoerper, protein phosphatase 1A, magnesium dependent, alpha isoform antikoerper, protein phosphatase, Mg2+/Mn2+ dependent, 1A antikoerper, protein phosphatase, Mg2+/Mn2+ dependent 1A L homeolog antikoerper, protein phosphatase, Mg2+/Mn2+ dependent, 1Aa antikoerper, PPM1A antikoerper, ppm1ab antikoerper, Ppm1a antikoerper, ppm1a.L antikoerper, ppm1aa antikoerper

Hintergrund: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways.

Molekulargewicht: 36 kDa (MW of target protein)