TOLLIP Antikörper (C-Term)

Produktnummer ABIN634351

Produktdetails anti-TOLLIP Antikörper

Target: TOLLIP (Toll Interacting Protein (TOLLIP))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TOLLIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TOLLIP antibody was raised against the C terminal of TOLLIP

Aufreinigung: Affinity purified

Immunogen: TOLLIP antibody was raised using the C terminal of TOLLIP corresponding to a region with amino acids MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TOLLIP Blocking Peptide, catalog no. 33R-5792, is also available for use as a blocking control in assays to test for specificity of this TOLLIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOLLIP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TOLLIP

Target: TOLLIP (Toll Interacting Protein (TOLLIP))

Andere Bezeichnung: TOLLIP (TOLLIP Produkte)

Synonyme: IL-1RAcPIP antikoerper, 4930403G24Rik antikoerper, 4931428G15Rik antikoerper, fk22a02 antikoerper, im:7145391 antikoerper, wu:fk22a02 antikoerper, zgc:76985 antikoerper, TOLLIP antikoerper, GB17961 antikoerper, tollip antikoerper, tollip1 antikoerper, tollipa antikoerper, TOLIP antikoerper, toll interacting protein antikoerper, toll-interacting protein antikoerper, toll-interacting protein-like antikoerper, toll interacting protein L homeolog antikoerper, toll interacting protein S homeolog antikoerper, Toll-interleukine I receptor interacting protein I antikoerper, TOLLIP antikoerper, Tollip antikoerper, tollip antikoerper, LOC552034 antikoerper, LOC100169858 antikoerper, tollip.L antikoerper, tollip.S antikoerper, LOC100136122 antikoerper

Hintergrund: TOLLIP is component of the signaling pathway of IL-1 and Toll-like receptors. It Inhibits cell activation by microbial products. It also recruits IRAK1 to the IL-1 receptor complex and inhibits IRAK1 phosphorylation and kinase activity.

Molekulargewicht: 30 kDa (MW of target protein)