MAP3K2 Antikörper (N-Term)

Produktnummer ABIN634340

Produktdetails anti-MAP3K2 Antikörper

Target: MAP3K2 (Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP3K2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAP3 K2 antibody was raised against the N terminal of MAP3 2

Aufreinigung: Affinity purified

Immunogen: MAP3 K2 antibody was raised using the N terminal of MAP3 2 corresponding to a region with amino acids AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP3K2 Blocking Peptide, catalog no. 33R-1147, is also available for use as a blocking control in assays to test for specificity of this MAP3K2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP3K2

Target: MAP3K2 (Mitogen-Activated Protein Kinase Kinase Kinase 2 (MAP3K2))

Andere Bezeichnung: MAP3K2 (MAP3K2 Produkte)

Synonyme: Mekk2 antikoerper, MEKK2 antikoerper, MEKK2B antikoerper, 9630061B06Rik antikoerper, AI585793 antikoerper, Mekk2b antikoerper, mitogen activated protein kinase kinase kinase 2 antikoerper, mitogen-activated protein kinase kinase kinase 2 antikoerper, Map3k2 antikoerper, MAP3K2 antikoerper

Hintergrund: MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: MAPK Signalweg