Peroxiredoxin 5 Antikörper (Middle Region)

Produktnummer ABIN634328

Produktdetails anti-Peroxiredoxin 5 Antikörper

Target: Peroxiredoxin 5 (PRDX5)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Peroxiredoxin 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRDX5 antibody was raised against the middle region of PRDX5

Aufreinigung: Affinity purified

Immunogen: PRDX5 antibody was raised using the middle region of PRDX5 corresponding to a region with amino acids TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRDX5 Blocking Peptide, catalog no. 33R-9012, is also available for use as a blocking control in assays to test for specificity of this PRDX5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Peroxiredoxin 5

Target: Peroxiredoxin 5 (PRDX5)

Andere Bezeichnung: PRDX5 (PRDX5 Produkte)

Synonyme: acr1 antikoerper, aoeb166 antikoerper, pmp20 antikoerper, prx-5 antikoerper, prx5 antikoerper, prxv antikoerper, sbbi10 antikoerper, GB16965 antikoerper, zgc:112318 antikoerper, PRDX5 antikoerper, CG 32920 antikoerper, CG 7217 antikoerper, CG32920 antikoerper, CG7217 antikoerper, Dmel\\CG7217 antikoerper, dPrx5 antikoerper, dprx5 antikoerper, ACR1 antikoerper, AOEB166 antikoerper, B166 antikoerper, PLP antikoerper, PMP20 antikoerper, PRDX6 antikoerper, PRXV antikoerper, prx-V antikoerper, AOPP antikoerper, Pmp20 antikoerper, Prdx6 antikoerper, PrxV antikoerper, Aoeb166 antikoerper, Prx V antikoerper, peroxiredoxin 5 L homeolog antikoerper, peroxiredoxin-5, mitochondrial antikoerper, peroxiredoxin 5 antikoerper, Peroxiredoxin 5 antikoerper, prdx5.L antikoerper, LOC552429 antikoerper, prdx5 antikoerper, PRDX5 antikoerper, Prx5 antikoerper, Prdx5 antikoerper

Hintergrund: PRDX5 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis