GRK5 Antikörper (Middle Region)

Produktnummer ABIN634307

Produktdetails anti-GRK5 Antikörper

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRK5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GRK5 antibody was raised against the middle region of GRK5

Aufreinigung: Affinity purified

Immunogen: GRK5 antibody was raised using the middle region of GRK5 corresponding to a region with amino acids FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRK5 Blocking Peptide, catalog no. 33R-3133, is also available for use as a blocking control in assays to test for specificity of this GRK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRK5

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Andere Bezeichnung: GRK5 (GRK5 Produkte)

Synonyme: GPRK5 antikoerper, Gprk5 antikoerper, si:dkey-171l20.1 antikoerper, GRK5 antikoerper, DKFZp468J1119 antikoerper, grk5 antikoerper, G protein-coupled receptor kinase 5 antikoerper, G protein-coupled receptor kinase 5 L homeolog antikoerper, GRK5 antikoerper, Grk5 antikoerper, grk5 antikoerper, grk5.L antikoerper

Hintergrund: GRK5 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling