PARK7/DJ1 Antikörper

Produktnummer ABIN634300

Produktdetails anti-PARK7/DJ1 Antikörper

Target: PARK7/DJ1 (PARK7) (Parkinson Protein 7 (PARK7))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARK7/DJ1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PARK7 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARK7 Blocking Peptide, catalog no. 33R-9402, is also available for use as a blocking control in assays to test for specificity of this PARK7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARK7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARK7/DJ1

Target: PARK7/DJ1 (PARK7) (Parkinson Protein 7 (PARK7))

Andere Bezeichnung: PARK7 (PARK7 Produkte)

Synonyme: DJ-1 antikoerper, DJ1 antikoerper, CAP1 antikoerper, Dj1 antikoerper, SP22 antikoerper, dj1 antikoerper, zgc:103725 antikoerper, park7b antikoerper, park7 antikoerper, park7a antikoerper, Parkinsonism associated deglycase antikoerper, Parkinson disease (autosomal recessive, early onset) 7 antikoerper, parkinson protein 7 antikoerper, parkinson protein 7 S homeolog antikoerper, parkinson protein 7 L homeolog antikoerper, PARK7 antikoerper, Park7 antikoerper, park7 antikoerper, park7.S antikoerper, park7.L antikoerper

Hintergrund: PARK7 belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Proton Transport